Skip to content

Vasoactive intestinal peptide (VIP) and pituitary adenylate cyclase-activating polypeptide (PACAP) are structurally related neuropeptides belonging to the secretin/glucagon superfamily. Both activate VPAC receptors with similar affinity but diverge at the PAC1 receptor, where PACAP acts selectively. This receptor selectivity creates distinct physiological profiles despite 68% sequence homology.

  • Sequence: 28 amino acids (HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH₂)
  • MW: 3,326 Da
  • pI: ~10.5
  • Structure: Amphipathic α-helix
  • Discovery: Said and Mutt in 1970
  • Distribution: CNS, gut, pancreas, cardiovascular system

Two bioactive forms exist:

  • PACAP-38: 38 amino acids (full-length, primary form)
  • PACAP-27: N-terminal 27 amino acids (conserved with VIP)
  • Sequence homology with VIP: 68% in first 27 residues
  • MW: 4,530 Da (PACAP-38)
  • Discovery: Miyata in 1989
  • Distribution: CNS, pituitary, adrenal medulla, testis

Both VIP and PACAP bind VPAC receptors with similar affinity:

ReceptorVIP EC₅₀PACAP EC₅₀Tissue Distribution
VPAC1~1 nM~1 nMPancreas, lung, liver, CNS
VPAC2~1 nM~1 nMBrain, heart, pancreas, GI tract

VPAC receptor activation stimulates adenylyl cyclase → cAMP → PKA, producing:

  • Vasodilation
  • Bronchodilation
  • Hormone secretion
  • Immune modulation

The PAC1 receptor is highly selective for PACAP over VIP:

ReceptorPACAP EC₅₀VIP EC₅₀Selectivity Ratio
PAC1~1 nM>1 µM>1000:1 (PACAP-selective)

PAC1 receptor activation stimulates:

  • Phospholipase C → IP3/DAG → calcium mobilization
  • Adenylyl cyclase (in some splice variants)
  • Neuronal differentiation
  • Neurotransmitter release
SystemEffectMechanism
CardiovascularVasodilation, hypotensioncAMP → smooth muscle relaxation
RespiratoryBronchodilationAirway smooth muscle relaxation
GastrointestinalFluid secretion, relaxationCrypt cell secretion, motility
EndocrineInsulin, glucagon releasePancreatic islet stimulation
ImmuneImmunomodulationT cell, macrophage activation
NeurotransmissionSlow EPSPCNS neurotransmitter
SystemEffectMechanism
NeuroendocrineACTH, GH, catecholamine releasePituitary and adrenal stimulation
NeurotransmissionFast EPSP, neuromodulationCalcium-dependent neurotransmitter release
NeuroprotectionNeuronal survivalcAMP/CREB pathway
DevelopmentNeural crest migrationCytoskeletal regulation
ImmuneMast cell degranulationPAC1 on mast cells
CardiovascularVasodilation (shared with VIP)VPAC-mediated
  • Highest concentration: GI tract (enteric neurons)
  • CNS: Cortex, hippocampus, hypothalamus
  • Cardiovascular: Heart, blood vessels
  • Immune: Lymphoid tissues
  • Highest concentration: Hypothalamus, pituitary
  • CNS: Widespread (higher than VIP in brain)
  • Peripheral: Adrenal medulla, testis, pancreas
  • Immune: Mast cells, macrophages
ApplicationMechanismStatus
Erectile dysfunctionVasodilationApproved (Invicorp)
Pulmonary hypertensionPulmonary vasodilationInvestigational
Cerebral vasospasmCerebral vasodilationInvestigational
AsthmaBronchodilationInvestigational
VIPoma syndromeDiagnostic markerClinical use
ApplicationMechanismStatus
MigraineCGRP pathway modulationInvestigational
NeurodegenerationNeuroprotectionPreclinical
Type 2 diabetesIncretin-like effectsInvestigational
PTSDFear extinction, anxiolysisInvestigational
Growth hormone deficiencyGH stimulationInvestigational
ParameterVIPPACAP-38
Half-life (plasma)1–2 minutes2–5 minutes
MetabolismDPP-IV, NEPDPP-IV, NEP
Stable analogsYes (VIP analogue)Yes (PACAP analogs)
Oral bioavailabilityNoneNone
CNS penetrationLimitedLimited

Both peptides are rapidly degraded by peptidases, necessitating engineered analogs for therapeutic use.

AnalogModificationHalf-lifeSelectivity
[R15,20,21,L27]-VIPMultiple substitutions~30 minVPAC-selective
Stearyl-VIPFatty acid acylation~2 hoursVPAC1/VPAC2
Ro 25-1553N-terminal modification~1 hourVPAC2-selective
AnalogModificationHalf-lifeSelectivity
PACAP 1-38 amideC-terminal amidation~10 minPAC1 + VPAC
[Ala16]-PACAPAla substitution~30 minPAC1-selective
MaxadilanMaxillary shark peptide~1 hourPAC1-selective
Side EffectIncidenceMechanism
Flushing30–50%Systemic vasodilation
Hypotension20–30%Vasodilation
Diarrhea20–30%GI secretion
Bronchospasm10–20%Paradoxical in asthma
Headache10–15%Cerebral vasodilation
Side EffectIncidenceMechanism
Flushing20–40%Vasodilation
Hypotension10–20%Vasodilation
Tachycardia10–20%Reflex response
Facial flushing30–50%Cutaneous vasodilation
Nausea10–15%GI effects
FeatureVIPPACAP
Size28 aa38 aa (or 27 aa)
MW3,326 Da4,530 Da
Sequence homology68% (with PACAP-27)68% (with VIP)
VPAC1/VPAC2 bindingHighHigh
PAC1 bindingNoneHigh (>1000× selectivity)
Primary functionVasodilation, secretionNeuroprotection, secretion
NeurotransmitterSlow EPSPFast EPSP
Stable analogsYesYes
Therapeutic stageApproved (ED)Investigational

The key distinction is PACAP’s selective activation of PAC1 receptors, which mediates neuroprotective, neurodevelopmental, and neuroendocrine functions absent from VIP pharmacology. This makes PACAP a candidate for neurodegenerative diseases, PTSD, and metabolic disorders where VIP’s vasodilatory profile is less relevant.

  1. Said SI, Mutt V. “Potent peripheral and splanchnic vasodilation peptide from porcine intestine.” Proc Natl Acad Sci 1970;67:706-713.
  2. Miyata A, et al. “PACAP: a novel pituitary adenylate cyclase-activating polypeptide.” Biochem Biophys Res Commun 1989;166:581-589.
  3. Vaudry D, et al. “Pituitary adenylate cyclase-activating polypeptide and its receptors: from structure to functions.” Pharmacol Rev 2000;52:269-324.
  4. Harmar AJ, et al. “VPAC receptors and VIP.” Pharmacol Rev 1998;50:265-299.
  5. Waschek JA. “VIP and PACAP: neuropeptide modulators of neural injury, repair, and adaptation.” Am J Physiol 2013;304:G535-G544.